PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC001127.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 375aa    MW: 41405.1 Da    PI: 4.8533
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC001127.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.1e-33177231155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   k+r+rWtpe He+Fveav+qLGGs++AtPk +l+lm+v+gLt++hvkSHLQkYR+
  EcC001127.10 177 KARMRWTPEHHEAFVEAVNQLGGSDRATPKGVLKLMNVEGLTIYHVKSHLQKYRT 231
                   68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.82174234IPR017930Myb domain
SuperFamilySSF466891.79E-18175231IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-31175233IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-24177231IPR006447Myb domain, plants
PfamPF002492.1E-9179230IPR001005SANT/Myb domain
PfamPF143792.9E-22264310IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
VTQMLFKNGT VGSGLSSASG CTSDICFSSP QQPERHAQYS PFISPASMIR TSTPPIGFPR  60
TEVQATALTD IPKESKDVLW DPNQLQDFLY SENVPSQNVQ LESSRGAVVG CDNQSAGSDL  120
IWTENFGEAM DLDWSKFLAD DDAIEPSKPP LAVQGQSLPP AESSAAANQL SSAPSSKARM  180
RWTPEHHEAF VEAVNQLGGS DRATPKGVLK LMNVEGLTIY HVKSHLQKYR TARYKPDSAE  240
SEGSSEKKLS SLEDMKSLDL KATMNITEAL RMQMEVQKQL HEQLEIQRKL QLRIEEQGRC  300
LQMLFEKQRN QTEATEQPEA EKGLETTNPS SSPGESSLNM NKRQKVSEAR TTDDDNPDEG  360
EMGLPSPKRV RGHEP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043308.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
SwissprotQ8GUN52e-72PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A059D5200.0A0A059D520_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s03750.16e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.33e-60G2-like family protein